DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and plekhn1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002936429.2 Gene:plekhn1 / 100491834 XenbaseID:XB-GENE-1004111 Length:724 Species:Xenopus tropicalis


Alignment Length:107 Identity:25/107 - (23%)
Similarity:48/107 - (44%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RLRWTFKLYDLNGDGRISRGELSEIILAIHELMGR--RPHQPEDDRKARDQVDR----VFRK--- 171
            |.:||   |....:..:.|..:|:.||  |.:.|:  ..|:.:     :|.||:    :|||   
 Frog    33 RTKWT---YLFGNESGVGRERISDNIL--HYIPGKDIGNHEIQ-----KDSVDQRFLSIFRKGKK 87

  Fly   172 --LDLNQDGIITIEEFLEACLKD--DLVTRSLQMFDNDLXXQ 209
              :..|...:|...: ::.|.::  |:....|::|.:.|..|
 Frog    88 KTIVRNMGQMIHYSK-VKFCFQNSQDISDCYLELFQSHLYFQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 20/86 (23%)
plekhn1XP_002936429.2 PH-like 98..197 CDD:388408 7/32 (22%)
PH-like 240..345 CDD:388408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.