DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip4

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002936758.1 Gene:kcnip4 / 100491280 XenbaseID:XB-GENE-5753458 Length:233 Species:Xenopus tropicalis


Alignment Length:199 Identity:96/199 - (48%)
Similarity:147/199 - (73%) Gaps:4/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAK 70
            |..:|:   ||| |...:..|.|||.|..||||||:|::::|||||.|||.|:|:|:.||||||:
 Frog    37 EDNVED---ELE-TATVRHRPEALELLEAQTKFTKKELQILYRGFKNECPSGIVNEETFKDIYAQ 97

  Fly    71 FFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRG 135
            |||.|::|.|||::|.|||.:.||::||.|.::.|||||||::.|:|.|.|.|||:|.||.|::.
 Frog    98 FFPQGDASTYAHFLFNAFDTDHNGSVSFEDFVIGLSTLLRGTIQEKLNWAFNLYDINKDGYITKE 162

  Fly   136 ELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            |:.:|:.:|:::||:..:....:...|..|:..|:|:|:|:||::|||||:|:|.||:.:..|:|
 Frog   163 EMFDIMKSIYDMMGKCTYPLVREETPRQHVENFFQKMDINKDGVVTIEEFIESCQKDENIMCSMQ 227

  Fly   201 MFDN 204
            :|:|
 Frog   228 LFEN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 82/162 (51%)
kcnip4XP_002936758.1 FRQ1 63..222 CDD:227455 80/158 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7187
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 211 1.000 Inparanoid score I3565
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513542at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm47690
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.