DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ccdc181

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_012813116.1 Gene:ccdc181 / 100380036 XenbaseID:XB-GENE-972794 Length:471 Species:Xenopus tropicalis


Alignment Length:189 Identity:41/189 - (21%)
Similarity:64/189 - (33%) Gaps:59/189 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVT 104
            |.|....|:...||..|.       :...|:.....|..|....:    |.|....:.|:|.||.
 Frog    78 KDETEAEYQDNDTEDEEA-------RRYIAEKIEEANKLLQTEII----DENRERKLKFKDNLVD 131

  Fly   105 LSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHEL-----MGRRPHQPEDDRKARDQ 164
            |...           ..:.:::..:...|..|  ||:..:.:|     .|...|:  ||:.:.::
 Frog   132 LEVP-----------PVEYHEMKDERNESADE--EIVDGLSQLHLSNATGTNEHR--DDKGSTEE 181

  Fly   165 VDRVFRKLDLNQDGIITIEEFLEACLKD---DLVTRSLQMFDNDLXXQEGELEPGLRNS 220
                      .:||.|.||       ||   :|||.|      |:  |  ...|.:.||
 Frog   182 ----------QKDGKILIE-------KDGKFELVTLS------DIESQ--SFLPPINNS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 30/156 (19%)
ccdc181XP_012813116.1 MDN1 <4..182 CDD:227596 25/139 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.