DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and guca1bl

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_004913416.1 Gene:guca1bl / 100379842 XenbaseID:XB-GENE-5838913 Length:233 Species:Xenopus tropicalis


Alignment Length:176 Identity:61/176 - (34%)
Similarity:96/176 - (54%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KQEIRV-----MYRGFKTECPEGV--VHEDCFKDIYAKFF---PHGNSSLYAHYVFKAFDVNCNG 94
            |.||.|     ||:.|.||||.|.  :||      :.:||   .:...|.:...:||:||.|.:.
 Frog    49 KDEIDVADLQDMYKKFVTECPSGALFLHE------FKQFFGVSANNEVSQFMESLFKSFDRNRDN 107

  Fly    95 AISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHEL-MGRRPHQPEDD 158
            .|.|.:.:..|:..|||.:..:|||:||:||.:|:|.:.:.||.|||.:|:.: .|.|..|....
 Frog   108 TIDFLEYVAALNLTLRGKLEHKLRWSFKIYDKDGNGCVDKRELKEIIQSIYSIKRGWRRDQEAQL 172

  Fly   159 RKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ....:..:|:|:.:|.|.||.::::||:|...||..|.:.||:..|
 Frog   173 MSPEEICERIFQIVDENGDGQLSLQEFVEGAKKDTWVLKMLQLDTN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 55/162 (34%)
guca1blXP_004913416.1 FRQ1 56..207 CDD:227455 52/156 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.