DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and si:ch211-103a14.5

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002666176.1 Gene:si:ch211-103a14.5 / 100330921 ZFINID:ZDB-GENE-091204-414 Length:192 Species:Danio rerio


Alignment Length:163 Identity:64/163 - (39%)
Similarity:94/163 - (57%) Gaps:17/163 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YRGFKTECPEGVVHEDCFKDIYAKFFPHGN----SSLYAHYVFKAFDVNCNGAISFRDLLVTLST 107
            ||.|.||||.|.:....||    |||...|    |:.|...:|:.||:|.:|.|.|.:.:..||.
Zfish    21 YRKFMTECPSGQLTFYEFK----KFFGLKNLSEKSNEYVMTMFQTFDMNDDGCIDFMEYVAALSL 81

  Fly   108 LLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKL 172
            :|:|.|.::|||.|||||::|.|.|.|.||..|:.||..:.|     .|.:..|.:..:.||.|:
Zfish    82 ILKGGVQQKLRWYFKLYDVDGSGCIDREELLLIVKAIRAING-----VEQEVSAEEFTNMVFEKI 141

  Fly   173 DLNQDGIITIEEFLEACLKDD----LVTRSLQM 201
            |||.||::|::||:|....|:    ::|:||.:
Zfish   142 DLNADGVLTMDEFMEGIQADEYLSTMLTQSLDL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 60/148 (41%)
si:ch211-103a14.5XP_002666176.1 EF-hand_8 29..79 CDD:290545 17/53 (32%)
EF-hand_7 55..112 CDD:290234 25/56 (45%)
EFh 58..116 CDD:238008 27/57 (47%)
EFh 90..159 CDD:238008 32/73 (44%)
EF-hand_7 91..158 CDD:290234 32/71 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.