DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ccp110

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_012826311.2 Gene:ccp110 / 100170501 XenbaseID:XB-GENE-981330 Length:962 Species:Xenopus tropicalis


Alignment Length:140 Identity:30/140 - (21%)
Similarity:49/140 - (35%) Gaps:45/140 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SPIE-EVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAK 70
            ||:| ...|::|   .|.||.:..:.                .|..||.|.|    .|.::.:.:
 Frog   522 SPVELNKSYDVE---TPSPILIQSQG----------------SGQATETPLG----PCLREPFLE 563

  Fly    71 FFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRG 135
            ..|               |:...     |.|.:.|.|....| .|:.||..|..:.:|..:::..
 Frog   564 NQP---------------DIQIK-----RRLELDLDTTPPAS-GEQKRWLHKQRNRSGSLQMTST 607

  Fly   136 ELSEIILAIH 145
            :||:..|..|
 Frog   608 DLSKGSLGDH 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 22/117 (19%)
ccp110XP_012826311.2 CALM_bind 32..104 CDD:406433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.