DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ncald

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001123413.1 Gene:ncald / 100170190 XenbaseID:XB-GENE-948387 Length:193 Species:Xenopus tropicalis


Alignment Length:175 Identity:68/175 - (38%)
Similarity:113/175 - (64%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90
            |..::||...|.||:.||:..|:||..:||.|.:..:.||.||..|||:|::|.:|.:||:.||.
 Frog    10 PEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLTMEEFKKIYGNFFPYGDASKFAEHVFRTFDA 74

  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            |.:|.|.||:.::.||...||.:.::|:|.|.:|||:|:|.||:.|:.||:.||::::......|
 Frog    75 NGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMP 139

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            ||:.....:.:::||::|.|:||.:::|||:.....|..:.|.||
 Frog   140 EDESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLLQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 63/162 (39%)
ncaldNP_001123413.1 FRQ1 14..179 CDD:227455 64/164 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.