DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and gdpd5

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_031751569.1 Gene:gdpd5 / 100145750 XenbaseID:XB-GENE-5789660 Length:601 Species:Xenopus tropicalis


Alignment Length:208 Identity:37/208 - (17%)
Similarity:71/208 - (34%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IPVALEDLCRQTKFTKQEIRVM-----YRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYV 84
            :|:.:...|   ...|:::.|.     :||.....||..:..      :.:...|....|.|. |
 Frog   209 VPLTISSPC---LMDKKDLGVKPQIFGHRGAPMLAPENTLMS------FQRALEHQAYGLQAD-V 263

  Fly    85 FKAFD--------------VNCNGAISFRDLLVTLSTLLRGSVYERLR-----------WT---F 121
            ..::|              .|.:|.  |.:|....|:::..:..|||.           ||   .
 Frog   264 MISYDGVPFLMHDRTLRRTTNIDGV--FPELSFVHSSMINWTDLERLNAGDWFLKTDPFWTASSL 326

  Fly   122 KLYDLNGDGRISRGELSEIILAIHE----LMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITI 182
            ...|....|..|..:|||:::...|    ::.:.|..|.:...|...::             :|:
 Frog   327 SPSDATQAGNQSVCKLSELLVLAKEYNATVLLKVPPLPYEHPYADSYIN-------------LTV 378

  Fly   183 EEFLEACLKDDLV 195
            ...|.:.:.::||
 Frog   379 STILASGISENLV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 34/199 (17%)
gdpd5XP_031751569.1 GDPD_GDE2 227..582 CDD:176550 33/187 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.