DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001107403.1 Gene:kcnip3 / 100135241 XenbaseID:XB-GENE-982010 Length:259 Species:Xenopus tropicalis


Alignment Length:203 Identity:92/203 - (45%)
Similarity:143/203 - (70%) Gaps:1/203 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPPESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKD 66
            ::.|:...:....|||.:.| :..|..||.|..||:||::|::.:|||||.|||.|:|.|:.||.
 Frog    56 SAAPQGSNDSTDSELELSAV-RHQPEGLEQLQAQTQFTRKELQSLYRGFKNECPSGLVDEETFKS 119

  Fly    67 IYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGR 131
            ||::|||.|:::.|||::|.|||::.||:|.|.|.::.||.||||||.|:|||.|.|||:|.||.
 Frog   120 IYSQFFPQGDATTYAHFLFNAFDMDRNGSIRFEDFVIGLSVLLRGSVTEKLRWAFNLYDINKDGY 184

  Fly   132 ISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVT 196
            |::.|:..|:.:|:::|||.......|..|.:.|::.|:|:|.|:||::|:|||:|.|.||:.:.
 Frog   185 ITKEEMLAIMKSIYDMMGRYTSPCVKDDAAFEHVEKFFQKMDRNRDGVVTLEEFIETCQKDENIM 249

  Fly   197 RSLQMFDN 204
            .|:|:|:|
 Frog   250 SSMQLFEN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 80/162 (49%)
kcnip3NP_001107403.1 FRQ1 82..248 CDD:227455 82/165 (50%)
EF-hand_8 108..155 CDD:290545 24/46 (52%)
EFh 133..195 CDD:238008 34/61 (56%)
EFh 169..240 CDD:238008 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7187
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 211 1.000 Inparanoid score I3565
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm47690
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.