powered by:
Protein Alignment CG5890 and igfbpl1
DIOPT Version :9
Sequence 1: | NP_001356889.1 |
Gene: | CG5890 / 43126 |
FlyBaseID: | FBgn0039380 |
Length: | 229 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002940304.1 |
Gene: | igfbpl1 / 100127182 |
XenbaseID: | XB-GENE-484137 |
Length: | 277 |
Species: | Xenopus tropicalis |
Alignment Length: | 48 |
Identity: | 11/48 - (22%) |
Similarity: | 17/48 - (35%) |
Gaps: | 20/48 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 EVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGV 58
:|....|...||.|| .|.::: ||.|:|:
Frog 168 QVYLSCEVKAVPTPI------------ITWKKV--------TESPQGI 195
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5890 | NP_001356889.1 |
FRQ1 |
29..192 |
CDD:227455 |
5/30 (17%) |
igfbpl1 | XP_002940304.1 |
IB |
29..104 |
CDD:197525 |
|
KAZAL_FS |
<111..148 |
CDD:381802 |
|
Ig |
159..257 |
CDD:386229 |
11/48 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165162851 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.