DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5886 and TXLNA

DIOPT Version :9

Sequence 1:NP_651435.1 Gene:CG5886 / 43125 FlyBaseID:FBgn0039379 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_016856050.1 Gene:TXLNA / 200081 HGNCID:30685 Length:579 Species:Homo sapiens


Alignment Length:338 Identity:124/338 - (36%)
Similarity:218/338 - (64%) Gaps:15/338 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AKKVAREEKQRDQKLEELVMKSLDECPSAEEKVKL-------LLQRHVDSEKNVSRLTAELRVLQ 64
            |....::.|:..::: .|:|::|:...:.|||:..       ||:.|.:|:|       ::::||
Human   191 ASLFCQDSKENGKEI-TLLMQTLNTLSTPEEKLAALCKKYAELLEEHRNSQK-------QMKLLQ 247

  Fly    65 RQMESQQREKEQVQRDLNKSVLMRDKLQEVCREQQRIIKSVKNESLLQIKVEEERRKESQTKFQS 129
            ::.....:||:.::.:.:|:||.|.||:.:|||.||..:|:|.|.:.:.:.|||:|||..:.||.
Human   248 KKQSQLVQEKDHLRGEHSKAVLARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQV 312

  Fly   130 SLNDVQKSLAKNNEENIKLRDYNIEMTKKLKLLAEQYQTREQHLEKLNEQVQLEAQLHQAKLQKC 194
            :|||:|..:.::||.|.|||..|:|:.::||.|.|||:.||:|::|:.:...|:.||..||||:.
Human   313 TLNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQA 377

  Fly   195 QVEAAMEKEILSKENQIGLEKLMQAQRAIKDLTDREHQLKEQLNIYTAKYDDFQQSLQKSNEVFG 259
            |......:|...:|....|::.:::||..:.:..:|..||:||.:||.|:::||.:|.||:|||.
Human   378 QEMLKEAEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFT 442

  Fly   260 SYKVELEKMSKHTKKIEKEALGWRQKYEKANAMVIDLATEKSLQTQHSERLQKQIQQLQKLLRAL 324
            ::|.|:|||:|..||:|||...:|.::|.:|..::::|.||:::.:..|.||.:||:|:||.|||
Human   443 TFKQEMEKMTKKIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRAL 507

  Fly   325 QLERTTLHKCLRD 337
            |.||..|:|.::|
Human   508 QTERNDLNKRVQD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5886NP_651435.1 Taxilin 22..328 CDD:286771 117/312 (38%)
TXLNAXP_016856050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 222 1.000 Domainoid score I2596
eggNOG 1 0.900 - - E1_KOG1850
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14062
Inparanoid 1 1.050 232 1.000 Inparanoid score I3435
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D532685at33208
OrthoFinder 1 1.000 - - FOG0001051
OrthoInspector 1 1.000 - - otm41262
orthoMCL 1 0.900 - - OOG6_105608
Panther 1 1.100 - - LDO PTHR16127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3923
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.