DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and AT5G01250

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_195745.1 Gene:AT5G01250 / 831833 AraportID:AT5G01250 Length:407 Species:Arabidopsis thaliana


Alignment Length:355 Identity:90/355 - (25%)
Similarity:151/355 - (42%) Gaps:72/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 KVSKKIPVIPL--------LDVLKAKKQPSR---------GQNIFFHETTNF-KRI--------E 119
            ::.:.||.:||        .|:||.:.|.:.         |.|:    :..| ||:        |
plant    64 EIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSGDNL----SDKFQKRVNEFVGDGCE 124

  Fly   120 KSSVVQLTA-------REACAIESAALHNPGLTVFVLFAGATHRPSSGDPLIRAL--HNYKNIRL 175
            .:.|:...:       ||..||||....:|...:.:|  .||.....|...::..  ..||.:.:
plant   125 VNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMIL--SATMDSPQGYATLKPFIDRGYKVLAV 187

  Fly   176 RHLNLWRYAAGTPIAKWL---KSGKLFKSKF-LFPHVSDLLRYVSLYKYGGLYLDLDVVVQQNLE 236
            .. :|.....||....||   ||||....|. |..::|:|:|...||||||:|||.|::|.::.:
plant   188 TP-DLPFLLKGTAGELWLDEIKSGKRDPGKISLAQNLSNLMRLAYLYKYGGVYLDTDMIVLKSFK 251

  Fly   237 KLPPNFTGAESNISVACGVMKMSPGGL----GHKIATMCLRDLEANYNANKWGTNGPGVITRVVK 297
            .| .|..||::....:....:::...|    .|.:....:.:....:|.|.||.|||.:::||.:
plant   252 GL-RNVIGAQTLDPSSTNWTRLNNAVLIFDKNHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVAR 315

  Fly   298 KQCNTDNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFFQPNRHNVTMKRVSKSPV------- 355
                      .:......| |.|...:.||:::||:.|..|:..:.....|.|....:       
plant   316 ----------AVEGSSGYN-FTVMRPSVFYSVNWLEIKKLFKVPKTEKDSKWVKTKLLHMQRNGY 369

  Fly   356 -IHVWNKFSKGWKVKTKSNCAYTTLAKIHC 384
             :|:|||||:.::::..|  |...|...||
plant   370 GLHLWNKFSRKYEIEQGS--AMWKLVSEHC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 39/117 (33%)
Gb3_synth 265..391 CDD:282437 32/128 (25%)
AT5G01250NP_195745.1 Gly_transf_sug 139..261 CDD:309577 42/125 (34%)
Gb3_synth 283..400 CDD:309631 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3714
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm1048
orthoMCL 1 0.900 - - OOG6_104694
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.