DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and AT3G09020

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_187514.1 Gene:AT3G09020 / 820054 AraportID:AT3G09020 Length:411 Species:Arabidopsis thaliana


Alignment Length:356 Identity:86/356 - (24%)
Similarity:149/356 - (41%) Gaps:59/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SLAKKAAKSVANQSKFKLD-KVSKKIPVIPLLDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQ 125
            |..|:.:..|.|....|.. .|.::|..:.:|:|...|....:    |....|.|.|.:......
plant    72 SSEKEVSDQVNNNYSIKQQITVKEEINKLQVLEVFGGKDVSEK----FQQRATEFLRDDCEVKFM 132

  Fly   126 LT---------AREACAIESA-ALHNPGLTVFVLFAGATHRPSSGDPL--IRALHNY--KNIRLR 176
            :|         .||..::||. ..|..|..:.:        .|:.|.|  .|.|..:  :..|:.
plant   133 MTWISPAELFGKREILSVESVFKSHARGCLMIL--------SSTMDSLQGFRILKPFLDRGYRVM 189

  Fly   177 HLN-----LWRYAAGTPIAKWLKSGKLFKSKF-LFPHVSDLLRYVSLYKYGGLYLDLDVVVQQNL 235
            .:.     |.:..||....:.:::||....|. |..::|:|:|...|:|:||:|||.|::|.::.
plant   190 AVTPDLPFLLKDTAGESWLEEIQTGKRDPGKISLAQNLSNLMRLAYLFKFGGVYLDTDMIVLKSF 254

  Fly   236 EKLPPNFTGAESNISVACGVMKMSPGGL----GHKIATMCLRDLEANYNANKWGTNGPGVITRVV 296
            :.| .|..||::...|:....:::...|    .|......:.:....:|.|.||.|||.:::||.
plant   255 KTL-RNVIGAQTLEPVSRNWTRLNNAVLIFDKNHPFLLKSIEEFALTFNGNVWGHNGPYLVSRVA 318

  Fly   297 KKQCNTDNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFFQPNRHNVTMKRV--------SKS 353
            :....||.....|..|.           |||.::|::.:..|:..|.....|||        .:|
plant   319 RAVEGTDGYNFTILTPP-----------AFYPVNWVEIEKLFKVPRTEKDSKRVQVKVLEMQKRS 372

  Fly   354 PVIHVWNKFSKGWKVKTKSNCAYTTLAKIHC 384
            ..:|:|||||:.::::..|  |...|....|
plant   373 YGLHLWNKFSRKFEIEQGS--AMDKLVSNQC 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 32/122 (26%)
Gb3_synth 265..391 CDD:282437 34/128 (27%)
AT3G09020NP_187514.1 Gly_transf_sug 143..265 CDD:398274 35/130 (27%)
Gb3_synth 287..404 CDD:398326 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3714
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm1048
orthoMCL 1 0.900 - - OOG6_104694
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X281
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.