DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and A4GNT

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_057245.1 Gene:A4GNT / 51146 HGNCID:17968 Length:340 Species:Homo sapiens


Alignment Length:313 Identity:83/313 - (26%)
Similarity:139/313 - (44%) Gaps:44/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALHNPGLTVFVLFAG---ATHRPSSGD-P 162
            |..:.|.|.||:  :|:|...:|      :|::||||...|...|.....|   :|..||:.. |
Human    47 SHRRGIVFLETS--ERMEPPHLV------SCSVESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYP 103

  Fly   163 LIRALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKSKFLFPHVSDLLRYVSLYKYGGLYLDL 227
            ....|....|:.|..|::.|....||:..|.........:......||..|...::||||:|:|.
Human   104 AFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDT 168

  Fly   228 DVVVQQNLEKLP-PNFTGAESNISVACGVMKMSPGGLGHKIATMCLRDLEANYNANKWGTNGPGV 291
            ||:   ::..:| .||..|:::...:.|:....|   .|.....|:.:...:||:..||..||.:
Human   169 DVI---SIRPIPEENFLAAQASRYSSNGIFGFLP---HHPFLWECMENFVEHYNSAIWGNQGPEL 227

  Fly   292 ITRVVKKQCNTDNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFF-----QPNRHNVTMKRVS 351
            :||:::..|..::.:.|  :..||..........||.||:.:|:.::     :|: .||      
Human   228 MTRMLRVWCKLEDFQEV--SDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPS-FNV------ 283

  Fly   352 KSPVIHVWNKFS-KGWKVKTKSNCAYTTLAKIHCPRSF---------AAAGEL 394
             |..:|:||..: :|..|...||.....|.:.||||::         :..|||
Human   284 -SYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGEL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 32/116 (28%)
Gb3_synth 265..391 CDD:282437 35/140 (25%)
A4GNTNP_057245.1 Gly_transf_sug 64..182 CDD:282357 34/126 (27%)
DXD motif. /evidence=ECO:0000250|UniProtKB:Q9JI93 167..169 1/1 (100%)
Gb3_synth 201..321 CDD:282437 35/129 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155307
Domainoid 1 1.000 62 1.000 Domainoid score I10334
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm8452
orthoMCL 1 0.900 - - OOG6_104694
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.