DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and AT2G38152

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001154561.1 Gene:AT2G38152 / 5007943 AraportID:AT2G38152 Length:380 Species:Arabidopsis thaliana


Alignment Length:417 Identity:97/417 - (23%)
Similarity:164/417 - (39%) Gaps:122/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVVGSLLLILSIVLTYKWIAYNHAYPKAQTELTNSTKKANLIDSKAKNKKHVQNSLAK-KAAKS 70
            |:|.|::|..:|:..|:.|     :.|.::...||..::.:|...|        |:.:: :.|..
plant    39 LVVAGTILSNMSLKSTFFW-----SSPTSEVIQTNRMERKSLAPPK--------NTTSRDRIAWL 90

  Fly    71 VANQSKFKLDKVSKKIPVIPLLDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACAIE 135
            .::.::|::.                           ||  .|.|...|     ....||..|:|
plant    91 HSHLTEFEVR---------------------------FF--MTWFSPAE-----YFGKREMLAVE 121

  Fly   136 SA-ALHNPGLTVFVLFAGATHRPSSGDPLIRALHN--YKNIRLRHLNLWRYAA---------GTP 188
            |. ..|..|..:.|  :|:.. ...||.:::.|::  ||          .:||         .||
plant   122 SVFKAHPQGCLMIV--SGSLD-SLQGDSILKPLNDRGYK----------VFAATPDMSLLLENTP 173

  Fly   189 IAKW---LKSGKLFKSKF-LFPHVSDLLRYVSLYKYGGLYLDLDVVVQQNLEKLPPNFTGAE--- 246
            ...|   :||.|....:. |..::|:|.|...||||||:|||.|.:|.::.:.| .|..||:   
plant   174 AKSWFQEMKSCKRDPGRIPLHQNLSNLARLAFLYKYGGVYLDTDFIVTRSFKGL-KNSIGAQTVV 237

  Fly   247 -------SNISVACGVMKMSPGGLGHKIATMCLRDLEANYNANKWGTNGPGVITRVVKKQCNT-- 302
                   :.::.|..:.:..     |.:....:.:..:.::.||||.|||.::|||.::...|  
plant   238 EGDSKNWTRLNNAVLIFEKD-----HPLVYSFIEEFASTFDGNKWGHNGPYLVTRVAQRARETIG 297

  Fly   303 DNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFFQPNRHN----------VTMKRVSKSPVIH 357
            ||             |.|....|||..:||.....||..|.:          |.:.|.|..  :|
plant   298 DN-------------FTVLPPVAFYPFNWLDIPRLFQTPRGSNDSTLLKTDLVKLNRESYG--LH 347

  Fly   358 VWNKFSKGWKVKTKSNCAYTTLAKIHC 384
            :|||.::  |:|.........:...||
plant   348 LWNKITR--KLKIGKGSVIDIIISDHC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 38/127 (30%)
Gb3_synth 265..391 CDD:282437 35/132 (27%)
AT2G38152NP_001154561.1 Gly_transf_sug 113..238 CDD:309577 41/138 (30%)
Gb3_synth 258..375 CDD:309631 35/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3714
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm1048
orthoMCL 1 0.900 - - OOG6_104694
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X281
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.