DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC101733668

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_004915066.1 Gene:LOC101733668 / 101733668 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:318 Identity:85/318 - (26%)
Similarity:147/318 - (46%) Gaps:49/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PVIPLLDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAA---LHNPGLTVFV 148
            |:.|..:||:      .|..|.|.|||:  |::..|:|      .|||||||   .|.|   |..
 Frog    46 PISPAQNVLR------DGNGIIFIETTD--RMKPPSLV------LCAIESAARVYRHRP---VVF 93

  Fly   149 LFAGATHRPSSGDPLIR--ALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKSKFLFPHV-SD 210
            ...|.....:..|.|.|  .|.::.|:.|..|.:.|...|||:..|.:.....:.:: :.|| ||
 Frog    94 FMEGLRDITAIRDTLKRLPTLSSFHNVHLFPLQMERLLNGTPLGPWYEKVNPERERY-WTHVSSD 157

  Fly   211 LLRYVSLYKYGGLYLDLDVVVQQNLEKLPP-NFTGAESNISVACGVMKMSPGGLGHKIATMCLRD 274
            ..|...::::||:|:|.|.:   ::..:|. ||..|:|:...:.|:..::|   .|..|...:..
 Frog   158 GCRLALIWRHGGIYMDSDFI---SMRPIPDVNFLAAKSSGVSSNGIFGLTP---QHTFAWKGMES 216

  Fly   275 LEANYNANKWGTNGPGVITRVVKKQC------NTDNIKSVINNPKRCNGFKVFDANAFYAISWLQ 333
            ...||...|||..||.:.|||:|:.|      :|:::|        |......:...||.|.:..
 Frog   217 FVQNYRGAKWGHQGPKLFTRVLKQYCIAPRFQSTEDVK--------CGNISFLNVKRFYPIPYPS 273

  Fly   334 WKDFFQPNRHNVTMKRVSKSPVIHVWNKFSKGWKVKTK-SNCAYTTLAKIHCPRSFAA 390
            |:.:::..::   :.:.:.|..:|:||..:|..|:... :|.....|.:::||..:.|
 Frog   274 WRRYYEVWQN---VPKFNDSYALHLWNFMNKEQKMMVPGNNTLVEHLYQLYCPTLYGA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 34/118 (29%)
Gb3_synth 265..391 CDD:282437 32/133 (24%)
LOC101733668XP_004915066.1 Gly_transf_sug 72..186 CDD:388717 36/126 (29%)
Gb3_synth 207..329 CDD:368001 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.