DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC101733382

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031758811.1 Gene:LOC101733382 / 101733382 -ID:- Length:350 Species:Xenopus tropicalis


Alignment Length:413 Identity:98/413 - (23%)
Similarity:152/413 - (36%) Gaps:117/413 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLILSIVLTYK-WIAYNHAYPKAQTELTNSTKKANLIDSKAKNKKHVQNSLAKKAAKSVANQSK 76
            :::::.|...|| .:.|...|.......||                   |..::|  :...|::|
 Frog    11 VMILMGIGFFYKVTVNYQKGYSIMSFTFTN-------------------NGTSQK--EEANNKTK 54

  Fly    77 FKLDKVSKKIPVIPLLDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALHN 141
            ..|...          ::|:      .|..|.|.|||:  |::...:|      .||:||||...
 Frog    55 SNLTPE----------EILR------NGNGIIFIETTD--RMQPPHLV------LCAVESAARIY 95

  Fly   142 PGLTVFVLFAGATHRPSSGD-----PLIRALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKS 201
            |...:.....|.....|..|     .....|.::.||.|..|.|....|.||:..|.|.      
 Frog    96 PNRPIAFFMKGLPDINSVEDEDKAKKRFPTLSSHDNIYLFPLRLEEVFANTPLLPWYKK------ 154

  Fly   202 KFLFPH--------VSDLLRYVSLYKYGGLYLDLDVVVQQNLEKLP-PNFTGAESNISVACGVMK 257
              :.||        .||..|...::|:||:|:|.|::   ::..:| .||..||.|:..:.|:..
 Frog   155 --INPHNEVYWTHVSSDGSRLALIWKHGGIYMDTDII---SIRPIPLTNFLAAEDNLYSSNGIFG 214

  Fly   258 MSPGGLGHKIATMCLRDLEANYNANKWGTNGPGVITRVVKK-QCNTDNIKS---------VINNP 312
            ..|   .|......:.|...||....||..||.:.||::|: .|:....||         ...||
 Frog   215 CLP---RHTFTWKSMEDFVQNYKGAVWGYQGPALFTRILKRFFCDKTGFKSKEDIMCGNITFTNP 276

  Fly   313 KRCNGFKVFDANAFYAISWLQWKDFFQPNRHNVTMKRVSKSPVIHVWNKFSKGWKVKTKSNCAYT 377
            :|           ||.|....|..:|:......|.   :.|..:|.:|..:||         |||
 Frog   277 ER-----------FYPIPGPTWMRYFEVWDKYPTF---NSSYGLHFFNFANKG---------AYT 318

  Fly   378 ------TLA----KIHCPRSFAA 390
                  |||    :.:||.::.|
 Frog   319 MVPGSKTLAEHLYQQYCPSTYGA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 33/125 (26%)
Gb3_synth 265..391 CDD:282437 37/146 (25%)
LOC101733382XP_031758811.1 Gly_transf_sug 81..195 CDD:418730 33/130 (25%)
Gb3_synth 219..342 CDD:398326 37/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D503304at33208
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.