DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100497665

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002941968.1 Gene:LOC100497665 / 100497665 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:342 Identity:98/342 - (28%)
Similarity:150/342 - (43%) Gaps:60/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FKLDKVSKKIPVIP---------LLDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREAC 132
            :::::....:..||         |.|||      |.|..|||.|||:  |::..|:|      .|
 Frog    21 YEINETETVVKYIPFFFYPTNFTLDDVL------SPGNGIFFIETTD--RMDPPSLV------LC 71

  Fly   133 AIESAALHNPGLTVFVLFAG--------ATHRPSSGDPLIRALHNYKNIRLRHLNLWRYAAGTPI 189
            |:||||..||...|.....|        ..:|..:..|   .|..|.||....|.:....:.||:
 Frog    72 AVESAARINPDRPVAFFMKGLPDINSAEGQNRARNSFP---TLAPYNNIYFFPLRMELLLSDTPL 133

  Fly   190 AKWLKSGKLFKSKFL-FPHV-SDLLRYVSLYKYGGLYLDLDVVVQQNLEKLP-PNFTGAESNISV 251
            ..|.:  |:...|.: :.|| ||..|...:|||||||:|:||:   :|..:| .||..|||:...
 Frog   134 LPWYQ--KVNPEKEVHWTHVSSDASRLALMYKYGGLYMDIDVI---SLRPVPVENFLVAESSQIS 193

  Fly   252 ACGVMKMSPGGLGHKIAT-MCLRDLEANYNANKWGTNGPGVITRVVKK-QCNTDNIKSVINNPKR 314
            :.||.    |...|:..| .|:.|...|||....|..||.:.|||.|: .|:....|.  :...:
 Frog   194 SNGVF----GFDSHRDFTWTCMEDFVKNYNGAIRGHQGPALFTRVFKQFYCDIPPFKG--DEDLK 252

  Fly   315 CNGFKVFDANAFYAISWLQWKDFFQPNRHNVTMKRVSKSPVIHVWNKFSKGWKVKTK---SNCAY 376
            |......:...||.|.|:::.|.::      .:...:||..:|::|...: :|.:..   ||...
 Frog   253 CGNISFLNPRRFYPIDWMKFFDIWK------AIPAFNKSYALHLFNSAHR-YKRRVMVPGSNTLV 310

  Fly   377 TTLAKIHCPRSFAAAGE 393
            ..|...:||.::.|..|
 Frog   311 EHLYIQNCPLTYQAVLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 39/122 (32%)
Gb3_synth 265..391 CDD:282437 32/130 (25%)
LOC100497665XP_002941968.1 Gly_transf_sug 66..178 CDD:388717 40/125 (32%)
Gb3_synth 206..325 CDD:368001 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D503304at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.