DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100497191

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002941966.3 Gene:LOC100497191 / 100497191 -ID:- Length:341 Species:Xenopus tropicalis


Alignment Length:332 Identity:100/332 - (30%)
Similarity:149/332 - (44%) Gaps:47/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DKVSKKIPVIPLLDVLKAKKQP----SRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALH 140
            :.|.|.||..     ..||..|    |.|..|||.|||:  |::..|:|      .||:||||..
 Frog    27 ETVVKFIPFF-----FHAKFTPDDILSPGNGIFFLETTD--RMDPPSLV------LCAVESAARI 78

  Fly   141 NPGLTVFVLFAGATHRP--SSGDPLIRALHN------YKNIRLRHLNLWRYAAGTPIAKWLKSGK 197
            ||...|.....|.   |  :|.:...:||::      |.||.|..|.:....:.||:..|.:...
 Frog    79 NPDKPVAFFMKGL---PDINSAEEHTQALNSFPTLAPYYNIYLFPLRMETLLSDTPLLPWYQKVN 140

  Fly   198 LFKSKFLFPHV-SDLLRYVSLYKYGGLYLDLDVVVQQNLEKLP-PNFTGAESNISVACGVMKMSP 260
            ..| :..:.|| ||..|...:|||||||:|.|::   :|..:| .||..|||:...:.||.    
 Frog   141 PVK-EVHWTHVSSDASRLALMYKYGGLYMDTDII---SLRPVPEKNFLVAESSQISSNGVF---- 197

  Fly   261 GGLGHKIAT-MCLRDLEANYNANKWGTNGPGVITRVVKK-QCNTDNIKSVINNPKRCNGFKVFDA 323
            |...|:..| .|:.|...|||...||..||.:.|||:|: .|:....|.  :...:|......:.
 Frog   198 GFDSHRDFTWTCMEDFVKNYNGAIWGHQGPALFTRVLKQFYCDIPPFKG--DEDLKCGNVSFLNP 260

  Fly   324 NAFYAISWLQWKDFFQPNRHNVTMKRVSKSPVIHVWNKFSKGWK--VKTKSNCAYTTLAKIHCPR 386
            ..||.|....|..||:..:.:...   ::|..:|::|..::|.:  :...||.....|...:||.
 Frog   261 RRFYPIECRYWMKFFEVWKADPPF---NESYALHLFNYANRGERRVMVPGSNTLVEHLYMRNCPA 322

  Fly   387 SFAAAGE 393
            ::.|..|
 Frog   323 TYQAVLE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 39/121 (32%)
Gb3_synth 265..391 CDD:282437 33/129 (26%)
LOC100497191XP_002941966.3 Gly_transf_sug 65..177 CDD:418730 40/124 (32%)
Gb3_synth 202..327 CDD:398326 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.