DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100495967

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002935130.1 Gene:LOC100495967 / 100495967 -ID:- Length:340 Species:Xenopus tropicalis


Alignment Length:319 Identity:86/319 - (26%)
Similarity:131/319 - (41%) Gaps:51/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LKAKKQPSR---------GQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALHNPGLTVFVLF 150
            |||...|||         |..|.|.|||:  |:|...:|      .|:|||||...|...|....
 Frog    32 LKALFFPSRYYPDDLLSAGNGIMFVETTD--RMEPPHLV------LCSIESAARAYPDRPVVYFM 88

  Fly   151 AGATHRPSSGDPLIR----ALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKSKFLFPHV-SD 210
            .|.....|.   ::|    .|.:|.||....|.:......||:..|.:.... |::..:.|| ||
 Frog    89 KGLAEINSD---IVRMSYPTLLSYDNIYFFPLRMNVLLNNTPLMPWYEKVNP-KTERYWNHVSSD 149

  Fly   211 LLRYVSLYKYGGLYLDLDVVVQQNL-EKLPPNFTGAESNISVACGVMKMSPGGLGHKIATMCLRD 274
            ..|...:|||||:|:|.|::..:.: ||   ||..||::......|:..:|   .|.|....:.|
 Frog   150 ACRLALIYKYGGIYMDTDIITFRPIPEK---NFLAAETSQMTGSAVLAFAP---KHTIVWQFMED 208

  Fly   275 LEANYNANKWGTNGPGVITRVVKK-QCNTDNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFF 338
            ....|:...||..||.:..|::.: .|.....|.  .....|......:...|:.:..:||:.||
 Frog   209 FVNGYDGTVWGQQGPLLYNRILNRLYCKVPPFKG--QEDIMCGTILFLNMERFFPVPGMQWETFF 271

  Fly   339 Q-----PNRHNVTMKRVSKSPVIHVWNKFSKGWK--VKTKSNCAYTTLAKIHCPRSFAA 390
            |     |..:|        |..:|::|..:...:  :...||.....|.|.:||.::.|
 Frog   272 QVCEKLPTFNN--------SYALHLFNYANSNQRKVMVPGSNTMVEHLYKKYCPITYHA 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 35/117 (30%)
Gb3_synth 265..391 CDD:282437 30/134 (22%)
LOC100495967XP_002935130.1 Gly_transf_sug 65..176 CDD:388717 34/120 (28%)
Gb3_synth 199..323 CDD:368001 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.