DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and a4galt

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002942110.3 Gene:a4galt / 100495236 XenbaseID:XB-GENE-493407 Length:346 Species:Xenopus tropicalis


Alignment Length:305 Identity:87/305 - (28%)
Similarity:138/305 - (45%) Gaps:35/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALHNPGLTVFVLFAG--ATH 155
            ||...|.....|: |:|.||:     |:.|.   .|:..||:|||...:|...|.:|..|  ..|
 Frog    61 DVPDGKNHSPTGR-IYFVETS-----ERMSP---NAQFMCAVESAVRTHPDTQVTILMRGLYQQH 116

  Fly   156 RPSSGDPLIRALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKSKFLFPHVSDLLRYVSLYKY 220
            .|...:...|....:.|:.:..|:..|..|.||::.|..:.:..|.....|.:||..|...|:||
 Frog   117 LPRPPNLAFRLFRCFPNVDVAPLDFERLFADTPLSSWYSAVEGHKEATDLPILSDASRLAILWKY 181

  Fly   221 GGLYLDLDVVVQQNLEKLPPNFTGAESNISVACGVMKMSPGGLGHKIATMCLRDLEANYNANKWG 285
            ||:|||.|.||.:.|..| .|..|.:|..::....:..:   .|||...:|::|...:||...:|
 Frog   182 GGVYLDTDFVVLKRLTNL-ANSMGTQSTYTLNGAFLSFA---RGHKFIELCMKDFTDSYNFWLYG 242

  Fly   286 TNGPGVITRVVKKQCNTDNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFFQPNRHNVTMKRV 350
            ..||.::|||.|:.|:...::    :.:.|.|..|....|||.|.|..|:.:|:....:.....:
 Frog   243 HQGPQLLTRVFKRWCSIRRLR----DRRSCRGVSVLPQEAFYPIEWQNWRKYFELISPSDLKGFL 303

  Fly   351 SKSPVIHVWNKFSKGWKV-------KTKSNCAYTTLAKIHCPRSF 388
            ..:..:|||||.||..:.       :.:|.|         ||.::
 Frog   304 RNTYAVHVWNKKSKDSRPEPGTFLDQLQSQC---------CPTAY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 37/113 (33%)
Gb3_synth 265..391 CDD:282437 35/131 (27%)
a4galtXP_002942110.3 Gly_transf_sug 89..199 CDD:418730 36/109 (33%)
Gb3_synth 222..342 CDD:398326 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9690
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.