DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100494545

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002935122.3 Gene:LOC100494545 / 100494545 -ID:- Length:341 Species:Xenopus tropicalis


Alignment Length:338 Identity:97/338 - (28%)
Similarity:139/338 - (41%) Gaps:51/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 KVSKKIPVIPLLDVLKAKKQP------------SRGQNIFFHETTNFKRIEKSSVVQLTAREACA 133
            |.:||..::|.  :|.:...|            ..|..|.|.|||:  |:|..|:|      .||
 Frog    21 KTTKKQSILPY--ILSSISTPFTNTSINPQGILKEGNGIIFLETTD--RMEPPSLV------LCA 75

  Fly   134 IESAALHNPGLTVFVLFAGATHRPSSGD-----PLIRALHNYKNIRLRHLNLWRYAAGTPIAKWL 193
            |||||.......|.....|.|...:..|     ....:|.:::|:.:..|.:......||:.||.
 Frog    76 IESAARVYTDRPVVFFMKGLTDINTEEDEKQAKKTFPSLSSFQNVYIFPLRMQELFKDTPLLKWF 140

  Fly   194 KSGKLFKSKFLFPHVSDLLRYVSLYKYGGLYLDLDVVVQQNLEKLPP-NFTGAESNISVACGVMK 257
            ......|.||...::||..|...:::|||.|.|.||:   ::..:|. ||..||.:.:....|..
 Frog   141 LKADPKKEKFWIHNLSDGCRMAMMWRYGGFYFDSDVI---SIRPIPEINFLTAEHDQTSGSSVFG 202

  Fly   258 MSPGGLGHKIATMCLRDLEANYNANKWGTNGPGVITRVVKKQCNTDNIKSVINNPKRCNGFKVFD 322
            ::|   .|..|...|.|...|||.|.||..||.:.|||:|:.|.....||:.|..  |.......
 Frog   203 LTP---HHSFAWTSLNDFVQNYNGNVWGNQGPTLFTRVLKQSCELSAFKSLDNIV--CGNISFLH 262

  Fly   323 ANAFYAISWLQWKDFFQ-----PNRHNVTMKRVSKSPVIHVWNKFSKGWK--VKTKSNCAYTTLA 380
            ....|.||:..||.:|:     |...|        |..:|:||..:.|.|  |...||.....|.
 Frog   263 PERIYPISYGGWKRYFEVWDKIPTFDN--------SYALHLWNYMNSGEKKTVVIGSNTLVENLY 319

  Fly   381 KIHCPRSFAAAGE 393
            |.:||..:....|
 Frog   320 KQYCPSIYGLLAE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 32/117 (27%)
Gb3_synth 265..391 CDD:282437 42/132 (32%)
LOC100494545XP_002935122.3 Gly_transf_sug 69..186 CDD:388717 34/125 (27%)
Gb3_synth 207..330 CDD:368001 42/132 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.