DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100493718

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031758609.1 Gene:LOC100493718 / 100493718 -ID:- Length:201 Species:Xenopus tropicalis


Alignment Length:223 Identity:65/223 - (29%)
Similarity:92/223 - (41%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSRTLIVVGSLLLIL--SIVLTYKWIAYNHAYPKAQTELTNSTKKANLIDSKAKNKKHVQNSLAK 65
            |:..||:..|.|||.  ||...|..||          ||.||..: ||..|.:....::.|... 
 Frog     8 VTFVLIITVSGLLIKQNSISNIYFIIA----------ELFNSNAR-NLNYSASWRADNLFNQTG- 60

  Fly    66 KAAKSVANQSKFKLD--------KVSKKIPVIPLLDVLKAKKQPSRGQNIFFHETTNFKRIEKSS 122
            ::|.:|..:||..|.        |.:|:...:...::|:      :|..|.|.||||  .:..||
 Frog    61 ESASAVTMKSKVLLSEGVDKFLLKPTKRTVTLSPREILR------KGDGIIFLETTN--SLRPSS 117

  Fly   123 VVQLTAREACAIESAA--LHNPGLTVFVLFAGATH-RPSSGDPLIR----ALHNYKNIRLRHLNL 180
            :|      .|||||||  .||..:..|:  .|.|. .....:..||    .|..|||:.:..|.|
 Frog   118 LV------LCAIESAAHVYHNRPVVFFM--KGLTDITTMEEESQIRNTFPTLATYKNVYIFPLRL 174

  Fly   181 WRYAAGTPIAKWLKSGKLFKSKFLFPHV 208
            ......||:..|.|.   |:..:..|.|
 Frog   175 EEIFEDTPLLPWYKK---FRKGYCGPTV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 27/87 (31%)
Gb3_synth 265..391 CDD:282437
LOC100493718XP_031758609.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.