DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100493555

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031758833.1 Gene:LOC100493555 / 100493555 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:308 Identity:88/308 - (28%)
Similarity:130/308 - (42%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALHNPGLTVFVLFAGATHRP 157
            ||||      .|..|.|.|||:  |::..|:|      .|||||||.......|.....|.....
 Frog    46 DVLK------EGNGIIFVETTD--RMKPPSLV------LCAIESAARVYKDRPVVFFMKGLQDIT 96

  Fly   158 SSGDPL-----IRALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKSKFLFPHVS-DLLRYVS 216
            ...|.|     ...|.::.|:....|.:.:....||:..|.|.... |.:..:.||| |..|...
 Frog    97 IIQDELEARQRFPTLSSFDNVYFFPLQMDKLFNDTPLMPWYKKVNP-KFEIYWTHVSADGCRLAL 160

  Fly   217 LYKYGGLYLDLDVVVQQNLEKLPP-NFTGAESNISVACGVMKMSPGGLGHKIATMCLRDLEANYN 280
            ::|:||:|:|.|::   ::..:|. ||..||.:.|.:.||..:|.   .|..:...:.:...|||
 Frog   161 VWKHGGIYMDSDII---SMRPIPDVNFLAAEYSQSSSNGVFGLSH---HHNFSWKSMENFVQNYN 219

  Fly   281 ANKWGTNGPGVITRVVKKQCNTDNIKSVINNPKRCNGFKVFDANAFYAISWLQWKDFFQ--PNRH 343
            ...||..||.:.||.:|..|.....||  |...:|......:...||.|.:..||.::.  ||  
 Frog   220 GAIWGNQGPQLFTRTLKTFCTIPQFKS--NEDVKCGNISFLNPKRFYPIPYGAWKRYYDVCPN-- 280

  Fly   344 NVTMKRVSKSPVIHVWNKFSKGWKVKTK-SNCAYTTLAKIHCPRSFAA 390
               :...:.|..:|.||..:|..|.... .|.....|.|.:||.::||
 Frog   281 ---VPTFNDSYALHFWNFMNKEQKTMVPGDNTLIEHLYKQYCPTTYAA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 31/118 (26%)
Gb3_synth 265..391 CDD:282437 36/129 (28%)
LOC100493555XP_031758833.1 Gly_transf_sug 66..183 CDD:418730 33/126 (26%)
Gb3_synth 204..326 CDD:398326 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.