DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and XB991164

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031758331.1 Gene:XB991164 / 100493399 XenbaseID:XB-GENE-991165 Length:311 Species:Xenopus tropicalis


Alignment Length:313 Identity:85/313 - (27%)
Similarity:138/313 - (44%) Gaps:46/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACAIESAALHNPGLTVFVLFAGATHR 156
            :|:|      |:|..|.|.|||:  |::..|:|      .|||||||.......|.....|.:..
 Frog    22 VDIL------SKGNGIIFVETTD--RMKPPSLV------LCAIESAARVYKDRPVVFFMKGLSRI 72

  Fly   157 PSSGD--------PLIRALHNYKNIRLRHLNLWRYAAGTPIAKWLKSGKLFKSKFLFPHV-SDLL 212
            ....|        |.:..|.|...:.||...::|   |||:..|.......|.|. :.|| ||..
 Frog    73 NLVNDELEVQKSFPTLSYLDNIYFLPLRMEEVFR---GTPLLPWYMKINPKKEKH-WTHVSSDGC 133

  Fly   213 RYVSLYKYGGLYLDLDVVVQQNLEKLPP-NFTGAESNISVACGVMKMSPGGLGHKIATMCLRDLE 276
            |...::|:||:|:|.|::   :|..:|. ||..|:|:...:.|:..:.|   .|..:...:.:..
 Frog   134 RLALIWKHGGIYMDTDII---SLRPIPDVNFLAAQSSQFSSNGIFGLFP---HHNFSWRSMENFV 192

  Fly   277 ANYNANKWGTNGPGVITRVVKKQCNTDNIKS---VINNPKRCNGFKVFDANAFYAISWLQWKDFF 338
            .|||...||..||.:.|||:.:.|.....||   |:     |......:...||.|.:.:|:.::
 Frog   193 QNYNGTIWGHQGPQLFTRVLGQDCVIPPFKSTEDVV-----CGNISFLNPQRFYPIPYPEWRKYY 252

  Fly   339 QPNRHNVTMKRVSKSPVIHVWNKFSKGWK-VKTKSNCAYTTLAKIHCPRSFAA 390
            :..:...|.   :.|..:|:||..::..: :...||.....|.|.:||.::.|
 Frog   253 EEWKDYPTF---NDSYALHLWNYMNQEQRTIIPGSNTLIDHLYKQYCPSTYGA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 35/121 (29%)
Gb3_synth 265..391 CDD:282437 32/130 (25%)
XB991164XP_031758331.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.