DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT2 and LOC100493232

DIOPT Version :9

Sequence 1:NP_651434.3 Gene:alpha4GT2 / 43124 FlyBaseID:FBgn0039378 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002938164.2 Gene:LOC100493232 / 100493232 -ID:- Length:331 Species:Xenopus tropicalis


Alignment Length:338 Identity:93/338 - (27%)
Similarity:145/338 - (42%) Gaps:46/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KSVANQSKFKLDKVSKKIPVIPLLDVLKAKKQPSRGQNIFFHETTNFKRIEKSSVVQLTAREACA 133
            |....:..|.|...:|..|.    |:|      |.|..:.|.|||:  |:|...:|      .|:
 Frog    22 KGSDKEKAFGLHFTAKFTPG----DIL------SVGNGVMFVETTD--RMEPPHLV------LCS 68

  Fly   134 IESAALHNPGLTVFVLFAGATHRPSSGDPLIRALH-----NYKNIRLRHLNLWRYAAGTPIAKWL 193
            |||||...|...|.....|.|...|..|.:....|     :|.||.|..|.:......||:..|.
 Frog    69 IESAARAYPDRPVVFFMKGLTEINSEEDEIQAKKHFPTLLSYDNIHLYPLRMGVLLKNTPLISWY 133

  Fly   194 KSGKLFKSKFLFPHV-SDLLRYVSLYKYGGLYLDLDVVVQQNLEKLPP-NFTGAESNISVACGVM 256
            :..|. |::..:.|: ||..|...:||:||||:|.|::   :|..:|. ||..|||:...:.||.
 Frog   134 EKIKP-KNEIHWTHISSDASRLALIYKFGGLYMDTDMI---SLRPVPDINFLAAESSQISSNGVF 194

  Fly   257 KMSPGGLGHKIATMCLRDLEANYNANKWGTNGPGVITRVVKKQCNT----DNIKSVINNPKRCNG 317
            ..:.   .|.....|:.|...|||...||..||.:.|||::::..|    :..:.::     |..
 Frog   195 GFAS---HHPFIWTCMEDFVKNYNGAIWGHQGPALFTRVLQERYCTLFPFEAKEDIL-----CGN 251

  Fly   318 FKVFDANAFYAISWLQWKDFFQPNRHNVTMKRVSKSPVIHVWNKFSKG-WKVKTK-SNCAYTTLA 380
            ....:...||.|....||.:|:....   :...::|..:|::|..::. .||... ||.....|.
 Frog   252 ISFLNPERFYPIPCSSWKKYFEVWEE---LPVFNESYALHLFNYANRDEHKVMIPGSNTLVEHLY 313

  Fly   381 KIHCPRSFAAAGE 393
            :.:||.::.|..|
 Frog   314 QQYCPATYQAVQE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT2NP_651434.3 Gly_transf_sug 129..241 CDD:303104 37/118 (31%)
Gb3_synth 265..391 CDD:282437 31/131 (24%)
LOC100493232XP_002938164.2 Gly_transf_sug 62..179 CDD:303104 38/126 (30%)
Gb3_synth 200..323 CDD:282437 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.