DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14354 and CG14841

DIOPT Version :9

Sequence 1:NP_651433.1 Gene:CG14354 / 43120 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_650350.1 Gene:CG14841 / 41735 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster


Alignment Length:250 Identity:108/250 - (43%)
Similarity:152/250 - (60%) Gaps:6/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIALPRLLCHILLYHLLMISSS---LAACYQRHSSCPQNQQQSRSQLLDQSADL--TMGIRQGN 60
            |.:.|..|.| :...|::|||.|   :|..|:..|...|......|:..:.|:.:  :.|:.|.|
  Fly    18 MCLFLLSLAC-VSRSHIIMISDSDPVVARLYEPASEKKQTASGGSSEGCETSSAVQNSCGLSQKN 81

  Fly    61 SKQTASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLAEKAIAAAKAAEAALAGKQQLMEQLQD 125
            :|..||:||.||||:||.|:|.|..|..||:.|||..|||||:.||:|||||||||||:||||:.
  Fly    82 AKSKASSIAIKAAQDAKAANDAQMAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIMEQLEL 146

  Fly   126 EVHEAEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQEL 190
            |..||..:|.|...||..:|.|...|:....:.:..|..|:..:..|...::|.|..|:|||.|:
  Fly   147 EEKEAVAVVDEVKNSLHSTQVNAESAMLAFSEAKIQLDQLKVLLAEATAQMTNIETFANGAQLEM 211

  Fly   191 CEKNQLVETARQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANEARNKAVRDRRS 245
            .||.||:|.|.:|.|.:.:|:.:|:.||..|:||||:|||||.||:.||.|.:|:
  Fly   212 DEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAACAAVEAKQKAQRMQRA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14354NP_651433.1 DUF745 59..239 CDD:283087 87/179 (49%)
CG14841NP_650350.1 DUF745 81..260 CDD:283087 87/178 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.