DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14354 and CG12985

DIOPT Version :9

Sequence 1:NP_651433.1 Gene:CG14354 / 43120 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster


Alignment Length:269 Identity:90/269 - (33%)
Similarity:145/269 - (53%) Gaps:37/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YQRHSSCPQN--QQQSRSQLLDQ----SADLTMGIRQGNSKQTASNIAQKAAQEAKKASDTQAPA 86
            :.|:..|.:|  :.:.|:.:.|:    |.|..:     ||:..|::|||.|||.||.|:|.||.|
  Fly    84 WDRNRGCDRNRDRDKDRNNIRDRDNCDSCDEII-----NSRLKATHIAQNAAQVAKAANDAQAAA 143

  Fly    87 ALAAARQVKHQLAEKAIAAAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNVA 151
            |..|:||.|.|||||||:||:||:|.|.|||.:::....|:.:||.:|.:.:.||..|:|||..:
  Fly   144 AQDASRQAKMQLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEAS 208

  Fly   152 VATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQELCEKNQLVETARQRAEMLMQQLRSAKL 216
            .|..|..:...::.|:.|:.....:|..::....:..::.||||::..|:.|.:.|.:|:..||.
  Fly   209 CAVVKAAEVQAETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKS 273

  Fly   217 DYTNTRKAAYRAACAANEARNK------------------AVR--DRRSYEED------IGGTFG 255
            :|...::||.|||.||.||:.|                  |:|  ..|.|..|      :...:.
  Fly   274 EYEQVKEAACRAASAAVEAKQKVGTGSLLYKSSVHRLPTVAIRANGARGYALDRNTCNALLDLYR 338

  Fly   256 QQQQQQQQM 264
            |:::|||:|
  Fly   339 QRRRQQQRM 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14354NP_651433.1 DUF745 59..239 CDD:283087 73/197 (37%)
CG12985NP_573255.1 DUF745 117..296 CDD:283087 72/178 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.