DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14354 and CG33257

DIOPT Version :9

Sequence 1:NP_651433.1 Gene:CG14354 / 43120 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster


Alignment Length:320 Identity:79/320 - (24%)
Similarity:143/320 - (44%) Gaps:65/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLCHILLYHLLMISSSLAACYQR---------------------HSSCPQNQQQSRSQLLDQSAD 51
            ||..::|  :|::|::|...::|                     |....:..:..:.|...:|..
  Fly     9 LLAQLVL--VLLLSNALGRLHKRNGYHYRPQQPPPIHQGGYFEPHLPAVEPPEPEKPQHSTKSYY 71

  Fly    52 LTMGIRQGNSKQTAS------------NIAQKAAQEAKKASDTQAPAALAAARQVKHQLAEKAIA 104
            .|.|   |:|..::.            :|||.:|.:|..|...|..||..||...::.||:.|..
  Fly    72 TTSG---GSSSVSSKGSGGYSIGSGLRSIAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQ 133

  Fly   105 AAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQSLRSSV 169
            ||..|:|||.|||.::::|:.:..||:..:..|...|..::.:..:|..||       |:....:
  Fly   134 AAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTA-------QAAHHHI 191

  Fly   170 KVAEEAVSNAEAAASGAQQ-------ELCEKNQLVETARQRAEMLMQQLRSAKLDYTNTRKAAYR 227
            .|...||:||::.|..|:|       :|..::|:|..::.|.|.:.:||..|::||..|:::|.:
  Fly   192 SVLTAAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALK 256

  Fly   228 AACAANEARNKAVRDRRSYEEDIGGTFGQQQQQQQQMLHNHDQPGNLQDPEVKGQVEGWE 287
            ||.:|..|:..|  .:.:....||     ..:......|.||      ..|:.|:.|.::
  Fly   257 AANSAAAAQVNA--SKAAQHATIG-----LHESTNPSAHGHD------GQELGGEEESYD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14354NP_651433.1 DUF745 59..239 CDD:283087 58/198 (29%)
CG33257NP_996107.1 DUF745 94..252 CDD:283087 51/164 (31%)
SNARE 195..240 CDD:304603 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.