DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and CABP2

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001305425.1 Gene:CABP2 / 51475 HGNCID:1385 Length:226 Species:Homo sapiens


Alignment Length:162 Identity:55/162 - (33%)
Similarity:89/162 - (54%) Gaps:15/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PPPE--ERTIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAE 70
            |||.  :|.:|     .|::::|::||..||......|....|...|.::.:.|::|||.||..:
Human    72 PPPNSYDRELR-----PEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQ 131

  Fly    71 IDADGSGELYLSDFLHIMSQRY----ANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQN-MGE 130
            |   ..|::...||:.:|..:.    |:|....|:..|||.||..|.|.||..|.|..::. :||
Human   132 I---SGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGE 193

  Fly   131 QLTDDEVEEIIRDANSDLEGNIDYVRFVRMMS 162
            :|:..||:||::|.:.:.:|.:|:..||||||
Human   194 RLSQREVDEILQDVDLNGDGLVDFEEFVRMMS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 47/146 (32%)
CABP2NP_001305425.1 PTZ00184 80..224 CDD:185504 48/151 (32%)

Return to query results.
Submit another query.