DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and Acam

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster


Alignment Length:143 Identity:57/143 - (39%)
Similarity:96/143 - (67%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDF 84
            |||||:.:.:.||..||.:.|..|....|..||.::...|::.|||::.||.:.:.:|:|..::|
  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68

  Fly    85 LHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLE 149
            ..||:::.....||:|:..||::||::|.|.||.:|.|.:|.|:||::||:|::|:||:|:.|.:
  Fly    69 CGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGD 133

  Fly   150 GNIDYVRFVRMMS 162
            |.|:|..||.|:|
  Fly   134 GMINYEEFVWMIS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 55/140 (39%)
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 57/143 (40%)

Return to query results.
Submit another query.