DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and Cam

DIOPT Version :9

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster


Alignment Length:144 Identity:65/144 - (45%)
Similarity:100/144 - (69%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDF 84
            |||||:.:.:.||||||......|....|..:|.|:...|::.|||::..|:||||:|.:...:|
  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69

  Fly    85 LHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLE 149
            |.:|:::..:..:|:||..|||||||:|.|.||.:|.||:|.|:||:|||:||:|:||:|:.|.:
  Fly    70 LTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGD 134

  Fly   150 GNIDYVRFVRMMST 163
            |.::|..||.||::
  Fly   135 GQVNYEEFVTMMTS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 63/140 (45%)
EFh 27..89 CDD:298682 22/61 (36%)
EFh 63..126 CDD:238008 29/62 (47%)
EFh 100..162 CDD:238008 35/61 (57%)
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 65/144 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443669
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
54.840

Return to query results.
Submit another query.