DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and TpnC41C

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_523619.2 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:146 Identity:45/146 - (30%)
Similarity:81/146 - (55%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDF 84
            ||:||...|..||:.||.:....|....:..::..:.|...|..|.:|.||:|.||||::...:|
  Fly     5 LTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEF 69

  Fly    85 LHIMSQRYANMSTE---DEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANS 146
            ..:.::.......|   .|:..|||::||||.|.|:....|.|::.:.::||:|:::.:|.:.:|
  Fly    70 TTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDS 134

  Fly   147 DLEGNIDYVRFVRMMS 162
            |..|.:|:..|:.:|:
  Fly   135 DGSGTVDFDEFMEVMT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 44/143 (31%)
TpnC41CNP_523619.2 PTZ00184 1..150 CDD:185504 44/144 (31%)

Return to query results.
Submit another query.