DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and CG31802

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster


Alignment Length:148 Identity:47/148 - (31%)
Similarity:83/148 - (56%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 THNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYL 81
            |.:|:..|..|::.||.|||.|.|..|....||..:.::...|...:::.:..|||.|.:|.:..
  Fly    36 TFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAF 100

  Fly    82 SDFLHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANS 146
            :|||::|..:.|...:..:::.||..||.:.||.||....:.:.:.:||||||:|::|:|.:||.
  Fly   101 NDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANV 165

  Fly   147 DLEGNIDYVRFVRMMSTT 164
            ..:|.:....|:.::..|
  Fly   166 SGDGEVSKEEFLNLIKKT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 45/141 (32%)
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 46/146 (32%)

Return to query results.
Submit another query.