DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and cam2

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:45/143 - (31%)
Similarity:85/143 - (59%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDFL 85
            ::||..:::.||.|:|.....:||.:::..::.|:....:|.||.::..|: .|...|   ..|:
pombe     4 SKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNEL-GDAIDE---KKFM 64

  Fly    86 HIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLEG 150
            ..:|.:.....:|:|.|.|||||||:.:|.|..::|...|:.:||:|:|:||:.::::|:....|
pombe    65 SFVSNKLRETESEEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEADPTNSG 129

  Fly   151 NIDYVRFV-RMMS 162
            :.||..|| |:|:
pombe   130 SFDYYDFVQRIMA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 44/140 (31%)
cam2NP_594877.1 PTZ00184 4..143 CDD:185504 45/143 (31%)

Return to query results.
Submit another query.