DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and Myl1

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_067260.1 Gene:Myl1 / 17901 MGIID:97269 Length:188 Species:Mus musculus


Alignment Length:163 Identity:44/163 - (26%)
Similarity:86/163 - (52%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPEER----TIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEI-- 67
            |.||:    .|:. ..::||.:|.:.||.|||......|.::.:..::.::...|::.|::::  
Mouse    27 PKEEKIDLSAIKI-EFSKEQQEDFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLG 90

  Fly    68 ---QAEIDADGSGELYLSDFLHIMSQRYANMSTE---DEIIAAFRVFDKEGTGLISESEFRHIMQ 126
               ..|::|.   ::....||.:| |..:|...:   ::.:...|||||||.|.:..:|.||::.
Mouse    91 NPSNEEMNAK---KIEFEQFLPMM-QAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLA 151

  Fly   127 NMGEQLTDDEVEEIIRDANSDLEGNIDYVRFVR 159
            .:||::.::|||.::. ...|..|.|:|..||:
Mouse   152 TLGEKMKEEEVEALLA-GQEDSNGCINYEAFVK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 40/149 (27%)
Myl1NP_067260.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 1/2 (50%)
PTZ00184 39..187 CDD:185504 40/151 (26%)

Return to query results.
Submit another query.