DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and mlc-5

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_499813.1 Gene:mlc-5 / 176796 WormBaseID:WBGene00011734 Length:142 Species:Caenorhabditis elegans


Alignment Length:139 Identity:36/139 - (25%)
Similarity:73/139 - (52%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDFLHI 87
            :.:.|....|:.||.:..:.|.:..:..::.::...|::.|:.:.....|.:  ..|...||:.|
 Worm     2 DDLADCREVFAYFDSKGDERISVQQVGDVLRALGQNPTEAEIHKCVGSFDRE--ARLSFEDFVPI 64

  Fly    88 MSQRYANMS--TEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLEG 150
            ......|..  |.:|.:.....|||||.|:|:.:|.||::..:||:|:|::|:::: ..::|..|
 Worm    65 FQSVSKNREKHTVEEFVEGLSHFDKEGNGMINVAELRHLLTTLGERLSDEDVDQLL-SGHNDSHG 128

  Fly   151 NIDYVRFVR 159
            |::...|||
 Worm   129 NVNISDFVR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 36/139 (26%)
mlc-5NP_499813.1 PTZ00184 2..140 CDD:185504 36/139 (26%)

Return to query results.
Submit another query.