DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and CALML6

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:90 Identity:25/90 - (27%)
Similarity:34/90 - (37%) Gaps:23/90 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ESIDLSDATISIPPEIQVDQIHIETPEERYERLLRRAKTEDLSEVSGIGCLYQSGVDRLGRPVVV 72
            :.:|.|||..       ||.||.:|....|...|           ..|......|:|:.|.|..:
Human   228 DRLDPSDAQF-------VDVIHSDTDALGYREAL-----------GHIDFYPNGGLDQPGCPKTI 274

  Fly    73 FCG-KWFPA-HNIDLEKALLYLIYL 95
            |.| |:|.. |.:.:   .|||..|
Human   275 FGGIKYFKCDHQMSV---FLYLASL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 21/79 (27%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.