DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17770 and MYL9

DIOPT Version :10

Sequence 1:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens


Alignment Length:36 Identity:10/36 - (27%)
Similarity:13/36 - (36%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GDYVIAYFH---TLTSSNNYPSLQWLKDVYSILPYK 134
            |.:.|..|.   |..|..::|.....|....|.|.|
Human   412 GQHAIDDFESKFTFHSMEDFPPPDEYKPCQKIYPSK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 10/36 (28%)
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PTZ00184 25..163 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.