DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and MLC1

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_011409.1 Gene:MLC1 / 852772 SGDID:S000003074 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:36/136 - (26%)
Similarity:68/136 - (50%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGS----GELYLSDFLYIMSKRY 93
            |.|||......|....|.|.|||:.:||....:||.   |:.|.|    ..|.|.....::....
Yeast    11 FTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDI---INADSSLRDASSLTLDQITGLIEVNE 72

  Fly    94 ENLTV-----EDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKI 153
            :.|..     .::.:.||:||||:.:|.:...:.|.::|..|:::.:.|::|:::..:.::..:|
Yeast    73 KELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEI 137

  Fly   154 DYVRFV 159
            ||.:|:
Yeast   138 DYKKFI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 36/136 (26%)
EFh 28..90 CDD:298682 19/60 (32%)
EFh 64..127 CDD:238008 16/71 (23%)
EFh 101..163 CDD:298682 16/59 (27%)
MLC1NP_011409.1 FRQ1 1..149 CDD:227455 36/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.