DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CMD1

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_009667.1 Gene:CMD1 / 852406 SGDID:S000000313 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:50/143 - (34%)
Similarity:90/143 - (62%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |.:||:.:.:.||||||.||...|....|...:|::..:|.|.|:.|.:.|||.||:.::..|:|
Yeast     5 LTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEF 69

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRD-ADANT 149
            |.:||::.::...|.|::.|||||||:|.|.|...|.:.::|..|:::.:.|:::|:|: :|.:.
Yeast    70 LALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSG 134

  Fly   150 ELKIDYVRFVTMM 162
            |:.|.  :|..::
Yeast   135 EINIQ--QFAALL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 50/143 (35%)
EFh 28..90 CDD:298682 23/61 (38%)
EFh 64..127 CDD:238008 25/62 (40%)
EFh 101..163 CDD:298682 21/63 (33%)
CMD1NP_009667.1 PTZ00184 1..145 CDD:185504 50/141 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.