DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CAM8

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_193200.1 Gene:CAM8 / 827114 AraportID:AT4G14640 Length:151 Species:Arabidopsis thaliana


Alignment Length:143 Identity:53/143 - (37%)
Similarity:93/143 - (65%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |..:|:.:.:.||.|||.|....|.::.|...:|::..||.|.|:.|.|||||:|.:|.:..::|
plant     6 LTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEF 70

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            |.:|:|:.:....|:|:..||||||||.:|:|..:|...:|...|:::.::|:|:||::||.:.:
plant    71 LNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKEADLDGD 135

  Fly   151 LKIDYVRFVTMMM 163
            .:::|..||.||:
plant   136 GQVNYDEFVKMMI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 52/141 (37%)
EFh 28..90 CDD:298682 23/61 (38%)
EFh 64..127 CDD:238008 26/62 (42%)
EFh 101..163 CDD:298682 24/61 (39%)
CAM8NP_193200.1 PTZ00184 6..148 CDD:185504 52/141 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.