DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and AT3G25600

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_189188.4 Gene:AT3G25600 / 822147 AraportID:AT3G25600 Length:161 Species:Arabidopsis thaliana


Alignment Length:144 Identity:38/144 - (26%)
Similarity:72/144 - (50%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLY- 87
            :|:|..:..||.||.|....:....|...||::...|..::|...:.:||.:|:|.:...:.:. 
plant     8 DQIKQLKDIFARFDMDKDGSLTQLELAALLRSLGIKPRGDQISLLLNQIDRNGNGSVEFDELVVA 72

  Fly    88 IMSKRYENLTVEDEVIL-AFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTEL 151
            |:....|.:.:..|.:: .|:.||:||:|.|...|....|.:.|..:...|:.||:.:||:|.:.
plant    73 ILPDINEEVLINQEQLMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYRELTEMMTEADSNGDG 137

  Fly   152 KIDYVRFVTMMMET 165
            .|.:..|..:|.::
plant   138 VISFNEFSHIMAKS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 37/140 (26%)
EFh 28..90 CDD:298682 15/62 (24%)
EFh 64..127 CDD:238008 16/64 (25%)
EFh 101..163 CDD:298682 19/62 (31%)
AT3G25600NP_189188.4 PTZ00184 1..148 CDD:185504 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.