DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CML11

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_188933.1 Gene:CML11 / 821865 AraportID:AT3G22930 Length:173 Species:Arabidopsis thaliana


Alignment Length:143 Identity:56/143 - (39%)
Similarity:93/143 - (65%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |..||:.:.:.||.|||.|....|....|...:|::..||.|.|:||.|||||:||:|.:..|:|
plant    28 LTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEF 92

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTE 150
            |.:|:.:.:....::|:..||||||||.:|:|..:|.|.:|...|:::.::|:::||::||.:.:
plant    93 LNLMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEADLDGD 157

  Fly   151 LKIDYVRFVTMMM 163
            .:::|..||.|||
plant   158 GQVNYDEFVRMMM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 54/141 (38%)
EFh 28..90 CDD:298682 26/61 (43%)
EFh 64..127 CDD:238008 28/62 (45%)
EFh 101..163 CDD:298682 24/61 (39%)
CML11NP_188933.1 PTZ00184 27..170 CDD:185504 54/141 (38%)
EFh 35..97 CDD:238008 26/61 (43%)
EFh 108..170 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.