DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and CAM2

DIOPT Version :10

Sequence 1:NP_651431.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001189724.1 Gene:CAM2 / 818710 AraportID:AT2G41110 Length:161 Species:Arabidopsis thaliana


Alignment Length:155 Identity:57/155 - (36%)
Similarity:95/155 - (61%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDN------------AKVIPIKLLRDCLRAVAHNPPENEIQDYITEID 73
            |.|:|:.:.:.||:|||.|.            ...|..|.|...:|::..||.|.|:||.|.|:|
plant     5 LTDDQISEFKEAFSLFDKDGDGMLHPPFPSIIVGCITTKELGTVMRSLGQNPTEAELQDMINEVD 69

  Fly    74 TDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEI 138
            .||:|.:...:||.:|:::.::...|:|:..||:|||||.:|||...|.|.:||..|:::.::|:
plant    70 ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEV 134

  Fly   139 EEMIRDADANTELKIDYVRFVTMMM 163
            :|||::||.:.:.:|:|..||.:||
plant   135 DEMIKEADVDGDGQINYEEFVKVMM 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_651431.1 PTZ00184 21..163 CDD:185504 55/153 (36%)
CAM2NP_001189724.1 PTZ00184 1..161 CDD:185504 57/155 (37%)

Return to query results.
Submit another query.