DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and AT2G41090

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_181642.1 Gene:AT2G41090 / 818708 AraportID:AT2G41090 Length:191 Species:Arabidopsis thaliana


Alignment Length:140 Identity:39/140 - (27%)
Similarity:76/140 - (54%) Gaps:3/140 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYI 88
            :|:.:....|:::|.:....|..:.....:|::..|..:.|:|:.|.:.|.||.|.:..::||..
plant     8 QQISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTEFLCA 72

  Fly    89 MSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKI 153
            |:|   :...|.::...|::||.|.:|||...|.|.:.|....:..::||:|:|:.||.:.:.:|
plant    73 MAK---DTYSEKDLKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAADVDGDGQI 134

  Fly   154 DYVRFVTMMM 163
            :|..|..:||
plant   135 NYREFARLMM 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 37/138 (27%)
EFh 28..90 CDD:298682 14/61 (23%)
EFh 64..127 CDD:238008 21/62 (34%)
EFh 101..163 CDD:298682 19/61 (31%)
AT2G41090NP_181642.1 PTZ00184 1..146 CDD:185504 39/140 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.