DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and cabp4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_021334000.1 Gene:cabp4 / 797905 ZFINID:ZDB-GENE-081104-291 Length:268 Species:Danio rerio


Alignment Length:165 Identity:48/165 - (29%)
Similarity:77/165 - (46%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VRTVHTHTLND----------EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQD 67
            :...:|..||.          |:|.:...||..||.|....:..|.:.||:|.:.:.|.|.|:.:
Zfish   101 IAAAYTQYLNSLFGQDRDLLPEELDELLEAFKEFDYDQDGYLHYKDVADCMRTMGYMPTEMELIE 165

  Fly    68 YITEIDTDGSGELYLSDFLYIMSKRYENLTVE----DEVILAFKVFDKDGSGFIHENEFRQ-IMT 127
            .|.:|.....|.:...||..:|..|....|..    .|:..|||.||.||.|.|...|.:: ..|
Zfish   166 IIQQIKMKWGGHVDFDDFCELMGPRMLAETAHMVGLRELHCAFKQFDCDGDGRITFEELKESTKT 230

  Fly   128 EYGDEMEEDEIEEMIRDADANTELKIDYVRFVTMM 162
            ..|:::::.|:||::.|.|.|.:..:|:..||.|:
Zfish   231 LLGEKLKKGELEEILTDIDLNGDGNVDFDEFVMML 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 47/157 (30%)
EFh 28..90 CDD:298682 17/61 (28%)
EFh 64..127 CDD:238008 20/67 (30%)
EFh 101..163 CDD:298682 23/63 (37%)
cabp4XP_021334000.1 EFh_PEF 130..265 CDD:330173 42/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.