DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Cabp4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_036017598.1 Gene:Cabp4 / 73660 MGIID:1920910 Length:297 Species:Mus musculus


Alignment Length:140 Identity:43/140 - (30%)
Similarity:71/140 - (50%) Gaps:5/140 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |..|:|::.:|||..||.|....|..:.|.||:|.:.:.|.|.|:.:....:.....|.:...:|
Mouse   122 LGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEEF 186

  Fly    86 LYIMSKRYENLTVE----DEVILAFKVFDKDGSGFIHENEFRQIMTE-YGDEMEEDEIEEMIRDA 145
            :.::|.:....|..    .|:.:||:.||||..|.|...|.||.... .|:.:|..|::||:|:.
Mouse   187 VELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLREM 251

  Fly   146 DANTELKIDY 155
            |.|.:..||:
Mouse   252 DLNGDGTIDF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 43/140 (31%)
EFh 28..90 CDD:298682 16/61 (26%)
EFh 64..127 CDD:238008 17/66 (26%)
EFh 101..163 CDD:298682 22/56 (39%)
Cabp4XP_036017598.1 PTZ00184 133..262 CDD:185504 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.