DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and Calml4

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001121047.1 Gene:Calml4 / 691455 RGDID:1583918 Length:153 Species:Rattus norvegicus


Alignment Length:144 Identity:38/144 - (26%)
Similarity:78/144 - (54%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDF 85
            |:.||:.:.:..|:|:|......|....|...:|.:..:|...|:|.::.....|.:|||..|.|
  Rat     5 LSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTF 69

  Fly    86 LYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDA--DAN 148
            |.||..:.:....:.|::||..:.||:..|:|..:|.|..:.:.|:::...|::|:.::|  :.|
  Rat    70 LTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKEAGIEPN 134

  Fly   149 TELKID-YVRFVTM 161
            .::|.| :::.:|:
  Rat   135 GQVKYDTFIQRITL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 38/144 (26%)
EFh 28..90 CDD:298682 17/61 (28%)
EFh 64..127 CDD:238008 20/62 (32%)
EFh 101..163 CDD:298682 17/64 (27%)
Calml4NP_001121047.1 PTZ00184 1..144 CDD:185504 37/138 (27%)
EFh 12..74 CDD:238008 17/61 (28%)
EFh 94..147 CDD:298682 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.