DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5024 and mylz3

DIOPT Version :9

Sequence 1:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_571694.1 Gene:mylz3 / 58143 ZFINID:ZDB-GENE-000322-6 Length:151 Species:Danio rerio


Alignment Length:149 Identity:35/149 - (23%)
Similarity:72/149 - (48%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTD--GSGELYLSDFL 86
            :|::|.:.||.|||......:....:.|.:||:..||...:::..:.:...|  .:..:....||
Zfish     8 DQIEDFKEAFGLFDRVGDSKVAYNQVADIMRALGQNPTNKDVKKILGDPSADDMANKRIDFEAFL 72

  Fly    87 YIMSKRYENLTVE-------DEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRD 144
            .::.      ||:       |:.:...:||||:|:|.:...|.|.:::..|::|.|.||:.:::.
Zfish    73 PMLK------TVDANQKGTYDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMSEPEIDALMQG 131

  Fly   145 ADANTELKIDYVRFVTMMM 163
            .:....: :.|..||..:|
Zfish   132 QEDENGM-VHYEAFVKNIM 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 34/147 (23%)
EFh 28..90 CDD:298682 14/63 (22%)
EFh 64..127 CDD:238008 14/71 (20%)
EFh 101..163 CDD:298682 16/61 (26%)
mylz3NP_571694.1 PTZ00184 1..150 CDD:185504 35/149 (23%)
EFh 12..76 CDD:298682 14/63 (22%)
EFh 94..146 CDD:238008 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.